PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G174600.1
Common NamePHAVU_001G174600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YB
Protein Properties Length: 211aa    MW: 23396.4 Da    PI: 7.5031
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G174600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.42.1e-5851148198
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yr
  Phvul.001G174600.1  51 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYR 141
                         69***************************************************************************************** PP

               NF-YB  92 elegekk 98 
                         e+eg++k
  Phvul.001G174600.1 142 EMEGDTK 148
                         ****975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-5548165IPR009072Histone-fold
SuperFamilySSF471139.47E-4154157IPR009072Histone-fold
PfamPF008085.1E-2857121IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-2085103No hitNo description
PROSITE patternPS00685088104IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-20104122No hitNo description
PRINTSPR006152.2E-20123141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
QIRVSSFFQF CHAFHRLFLS QIRVPANMAD GPSSPGGGSH ESGDHSPRSN VREQDRYLPI  60
ANISRIMKKA LPANGKIAKD AKETVQECVS EFISFITSEA SDKCQREKRK TINGDDLLWA  120
MATLGFEDYI DPLKIYLTRY REMEGDTKGS AKGGETSAKK DVQPNPNAQL AHQGSFSQGV  180
SYTNSQVTIL SLFDVLSSFF LFFWAVNVEC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-4752142393NF-YB
4awl_B6e-4752142494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4752142494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B5e-4751142192Transcription factor HapC (Eurofung)
4g92_B5e-4751142192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-123AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162720.11e-158hypothetical protein PHAVU_001G174600g, partial
SwissprotQ67XJ28e-83NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBLV7CX891e-158V7CX89_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA19G36220.21e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.14e-82nuclear factor Y, subunit B10